Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  8. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  9. Avatar for Team Canada 20. Team Canada 1 pt. 8,741

  1. Avatar for jsfoldingaccount 131. jsfoldingaccount Lv 1 4 pts. 9,267
  2. Avatar for WilliamII 132. WilliamII Lv 1 4 pts. 9,262
  3. Avatar for Crossed Sticks 133. Crossed Sticks Lv 1 4 pts. 9,262
  4. Avatar for CAN1958 134. CAN1958 Lv 1 4 pts. 9,253
  5. Avatar for sitlux 135. sitlux Lv 1 3 pts. 9,249
  6. Avatar for rout 136. rout Lv 1 3 pts. 9,238
  7. Avatar for dam904 137. dam904 Lv 1 3 pts. 9,231
  8. Avatar for xythus 138. xythus Lv 1 3 pts. 9,213
  9. Avatar for donuts554 139. donuts554 Lv 1 3 pts. 9,207
  10. Avatar for RabbitXVI 140. RabbitXVI Lv 1 3 pts. 9,206

Comments