Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  8. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  9. Avatar for Team Canada 20. Team Canada 1 pt. 8,741

  1. Avatar for Slense 181. Slense Lv 1 1 pt. 8,856
  2. Avatar for Alec_C 182. Alec_C Lv 1 1 pt. 8,836
  3. Avatar for HMK 183. HMK Lv 1 1 pt. 8,830
  4. Avatar for Yamatada 184. Yamatada Lv 1 1 pt. 8,830
  5. Avatar for YellowBearPL 185. YellowBearPL Lv 1 1 pt. 8,828
  6. Avatar for WarpWorld 187. WarpWorld Lv 1 1 pt. 8,828
  7. Avatar for 1234567891011 188. 1234567891011 Lv 1 1 pt. 8,825
  8. Avatar for ohbe1 189. ohbe1 Lv 1 1 pt. 8,824
  9. Avatar for KiTCCCCC 190. KiTCCCCC Lv 1 1 pt. 8,822

Comments