Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  8. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  9. Avatar for Team Canada 20. Team Canada 1 pt. 8,741

  1. Avatar for jobo0502 11. jobo0502 Lv 1 83 pts. 9,743
  2. Avatar for georg137 12. georg137 Lv 1 81 pts. 9,741
  3. Avatar for Mikisp 13. Mikisp Lv 1 80 pts. 9,731
  4. Avatar for guineapig 14. guineapig Lv 1 78 pts. 9,730
  5. Avatar for Xartos 15. Xartos Lv 1 77 pts. 9,730
  6. Avatar for g_b 16. g_b Lv 1 75 pts. 9,730
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 74 pts. 9,729
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 72 pts. 9,726
  9. Avatar for silent gene 19. silent gene Lv 1 71 pts. 9,726
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 69 pts. 9,724

Comments