Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Eastern Prehistoric Force 17. Eastern Prehistoric Force 1 pt. 9,322
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  9. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  10. Avatar for Team Canada 20. Team Canada 1 pt. 8,741
  1. Avatar for 396595 201. 396595 Lv 1 1 pt. 8,707
  2. Avatar for JoaoJesus 202. JoaoJesus Lv 1 1 pt. 8,696
  3. Avatar for alyssa_d_V2.0 203. alyssa_d_V2.0 Lv 1 1 pt. 8,694
  4. Avatar for Catenanes 204. Catenanes Lv 1 1 pt. 8,689
  5. Avatar for LizzieBelmonte 205. LizzieBelmonte Lv 1 1 pt. 8,686
  6. Avatar for thiagomaia 206. thiagomaia Lv 1 1 pt. 8,677
  7. Avatar for harvardman 207. harvardman Lv 1 1 pt. 8,661
  8. Avatar for rene1010 208. rene1010 Lv 1 1 pt. 8,636
  9. Avatar for Nups1983 209. Nups1983 Lv 1 1 pt. 8,634
  10. Avatar for tombickle 210. tombickle Lv 1 1 pt. 8,633

Comments