Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Eastern Prehistoric Force 17. Eastern Prehistoric Force 1 pt. 9,322
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  9. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  10. Avatar for Team Canada 20. Team Canada 1 pt. 8,741
  1. Avatar for vanemyosotis 231. vanemyosotis Lv 1 1 pt. 8,110
  2. Avatar for eromana 232. eromana Lv 1 1 pt. 7,950
  3. Avatar for UA_Trey 233. UA_Trey Lv 1 1 pt. 7,896
  4. Avatar for fischy92 234. fischy92 Lv 1 1 pt. 7,889
  5. Avatar for Tomas Ruiz Diaz 235. Tomas Ruiz Diaz Lv 1 1 pt. 7,846
  6. Avatar for C1234C5678 236. C1234C5678 Lv 1 1 pt. 7,629
  7. Avatar for KathlDattl 237. KathlDattl Lv 1 1 pt. 6,863
  8. Avatar for Bronzebart 238. Bronzebart Lv 1 1 pt. 6,623
  9. Avatar for mila60 239. mila60 Lv 1 1 pt. 5,640
  10. Avatar for yjnbgh 240. yjnbgh Lv 1 1 pt. 3,688

Comments