Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Eastern Prehistoric Force 17. Eastern Prehistoric Force 1 pt. 9,322
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  9. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  10. Avatar for Team Canada 20. Team Canada 1 pt. 8,741
  1. Avatar for Fat Tony 51. Fat Tony Lv 1 36 pts. 9,602
  2. Avatar for kitek314_pl 52. kitek314_pl Lv 1 35 pts. 9,594
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 34 pts. 9,593
  4. Avatar for aznarog 54. aznarog Lv 1 33 pts. 9,586
  5. Avatar for argyrw 55. argyrw Lv 1 33 pts. 9,585
  6. Avatar for inhtih 56. inhtih Lv 1 32 pts. 9,583
  7. Avatar for hansvandenhof 57. hansvandenhof Lv 1 31 pts. 9,574
  8. Avatar for GuR0 58. GuR0 Lv 1 30 pts. 9,569
  9. Avatar for Vinara 59. Vinara Lv 1 30 pts. 9,568
  10. Avatar for jausmh 60. jausmh Lv 1 29 pts. 9,560

Comments