Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 5 pts. 9,647
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,594
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 9,569
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,526
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,494
  6. Avatar for Hold My Beer 16. Hold My Beer 1 pt. 9,481
  7. Avatar for Eastern Prehistoric Force 17. Eastern Prehistoric Force 1 pt. 9,322
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,146
  9. Avatar for Fox Folds 19. Fox Folds 1 pt. 9,099
  10. Avatar for Team Canada 20. Team Canada 1 pt. 8,741
  1. Avatar for aendgraend 71. aendgraend Lv 1 22 pts. 9,511
  2. Avatar for alwen 72. alwen Lv 1 22 pts. 9,508
  3. Avatar for manu8170 73. manu8170 Lv 1 21 pts. 9,504
  4. Avatar for Glen B 74. Glen B Lv 1 20 pts. 9,498
  5. Avatar for nathalie friess salido 75. nathalie friess salido Lv 1 20 pts. 9,498
  6. Avatar for ShadowTactics 76. ShadowTactics Lv 1 19 pts. 9,497
  7. Avatar for versat82 77. versat82 Lv 1 19 pts. 9,494
  8. Avatar for MrZanav 78. MrZanav Lv 1 18 pts. 9,493
  9. Avatar for pente_player 79. pente_player Lv 1 18 pts. 9,492
  10. Avatar for Trajan464 80. Trajan464 Lv 1 18 pts. 9,486

Comments