Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,764
  2. Avatar for TECHFREAK 2. TECHFREAK Lv 1 99 pts. 9,763
  3. Avatar for Galaxie 3. Galaxie Lv 1 97 pts. 9,762
  4. Avatar for mirp 4. mirp Lv 1 95 pts. 9,760
  5. Avatar for Aubade01 5. Aubade01 Lv 1 93 pts. 9,757
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 91 pts. 9,757
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 90 pts. 9,754
  8. Avatar for Phyx 8. Phyx Lv 1 88 pts. 9,752
  9. Avatar for KarenCH 9. KarenCH Lv 1 86 pts. 9,750
  10. Avatar for Deleted player 10. Deleted player pts. 9,747

Comments