Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 13 pts. 9,451
  2. Avatar for wboler 92. wboler Lv 1 13 pts. 9,445
  3. Avatar for HuubR 93. HuubR Lv 1 12 pts. 9,438
  4. Avatar for allie_heather47 94. allie_heather47 Lv 1 12 pts. 9,434
  5. Avatar for heather-1 95. heather-1 Lv 1 12 pts. 9,430
  6. Avatar for Polarstern 96. Polarstern Lv 1 11 pts. 9,427
  7. Avatar for alcor29 97. alcor29 Lv 1 11 pts. 9,422
  8. Avatar for abiogenesis 98. abiogenesis Lv 1 11 pts. 9,421
  9. Avatar for tangofox10 99. tangofox10 Lv 1 10 pts. 9,419
  10. Avatar for OeshaHari 100. OeshaHari Lv 1 10 pts. 9,417

Comments