Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for roman madala 121. roman madala Lv 1 5 pts. 9,320
  2. Avatar for pauldunn 122. pauldunn Lv 1 5 pts. 9,318
  3. Avatar for infjamc 123. infjamc Lv 1 5 pts. 9,303
  4. Avatar for pfirth 124. pfirth Lv 1 5 pts. 9,301
  5. Avatar for wudoo 125. wudoo Lv 1 5 pts. 9,297
  6. Avatar for Jaixmemly 126. Jaixmemly Lv 1 5 pts. 9,295
  7. Avatar for puxatudo 127. puxatudo Lv 1 4 pts. 9,291
  8. Avatar for badgoes 128. badgoes Lv 1 4 pts. 9,284
  9. Avatar for Arne Heessels 129. Arne Heessels Lv 1 4 pts. 9,281
  10. Avatar for Bucsan 130. Bucsan Lv 1 4 pts. 9,277

Comments