Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629

  1. Avatar for Dolichwier 141. Dolichwier Lv 1 3 pts. 9,201
  2. Avatar for rinze 142. rinze Lv 1 3 pts. 9,194
  3. Avatar for Auntecedent 143. Auntecedent Lv 1 3 pts. 9,181
  4. Avatar for GamerDragonfly 144. GamerDragonfly Lv 1 3 pts. 9,164
  5. Avatar for kathy65 145. kathy65 Lv 1 2 pts. 9,162
  6. Avatar for Superphosphate 146. Superphosphate Lv 1 2 pts. 9,153
  7. Avatar for pangaena 147. pangaena Lv 1 2 pts. 9,152
  8. Avatar for Tlaloc 148. Tlaloc Lv 1 2 pts. 9,146
  9. Avatar for molleke 149. molleke Lv 1 2 pts. 9,113
  10. Avatar for MiaRidgway 150. MiaRidgway Lv 1 2 pts. 9,099

Comments