Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for pruneau_44 161. pruneau_44 Lv 1 1 pt. 9,036
  2. Avatar for iplfd 162. iplfd Lv 1 1 pt. 9,029
  3. Avatar for froschi2 163. froschi2 Lv 1 1 pt. 9,021
  4. Avatar for xabxs 164. xabxs Lv 1 1 pt. 9,006
  5. Avatar for snehaqtr.17@gmail.com 165. snehaqtr.17@gmail.com Lv 1 1 pt. 9,000
  6. Avatar for PMV1935 166. PMV1935 Lv 1 1 pt. 8,956
  7. Avatar for Barry1321 167. Barry1321 Lv 1 1 pt. 8,943
  8. Avatar for AlizarinAK 168. AlizarinAK Lv 1 1 pt. 8,927
  9. Avatar for Evg9944 169. Evg9944 Lv 1 1 pt. 8,923
  10. Avatar for Lirith 170. Lirith Lv 1 1 pt. 8,922

Comments