Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for jobo0502 11. jobo0502 Lv 1 83 pts. 9,743
  2. Avatar for georg137 12. georg137 Lv 1 81 pts. 9,741
  3. Avatar for Mikisp 13. Mikisp Lv 1 80 pts. 9,731
  4. Avatar for guineapig 14. guineapig Lv 1 78 pts. 9,730
  5. Avatar for Xartos 15. Xartos Lv 1 77 pts. 9,730
  6. Avatar for g_b 16. g_b Lv 1 75 pts. 9,730
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 74 pts. 9,729
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 72 pts. 9,726
  9. Avatar for silent gene 19. silent gene Lv 1 71 pts. 9,726
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 69 pts. 9,724

Comments