Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629

  1. Avatar for 396595 201. 396595 Lv 1 1 pt. 8,707
  2. Avatar for JoaoJesus 202. JoaoJesus Lv 1 1 pt. 8,696
  3. Avatar for alyssa_d_V2.0 203. alyssa_d_V2.0 Lv 1 1 pt. 8,694
  4. Avatar for Catenanes 204. Catenanes Lv 1 1 pt. 8,689
  5. Avatar for LizzieBelmonte 205. LizzieBelmonte Lv 1 1 pt. 8,686
  6. Avatar for thiagomaia 206. thiagomaia Lv 1 1 pt. 8,677
  7. Avatar for harvardman 207. harvardman Lv 1 1 pt. 8,661
  8. Avatar for rene1010 208. rene1010 Lv 1 1 pt. 8,636
  9. Avatar for Nups1983 209. Nups1983 Lv 1 1 pt. 8,634
  10. Avatar for tombickle 210. tombickle Lv 1 1 pt. 8,633

Comments