Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629

  1. Avatar for lwelite 211. lwelite Lv 1 1 pt. 8,622
  2. Avatar for Deleted player 212. Deleted player pts. 8,618
  3. Avatar for frostschutz 213. frostschutz Lv 1 1 pt. 8,611
  4. Avatar for chlorowolf 214. chlorowolf Lv 1 1 pt. 8,594
  5. Avatar for Miguelan15 215. Miguelan15 Lv 1 1 pt. 8,589
  6. Avatar for RW-QuantumSec 216. RW-QuantumSec Lv 1 1 pt. 8,555
  7. Avatar for mikemarkelov 217. mikemarkelov Lv 1 1 pt. 8,546
  8. Avatar for MephistoMUC 218. MephistoMUC Lv 1 1 pt. 8,532
  9. Avatar for Aaran 219. Aaran Lv 1 1 pt. 8,523
  10. Avatar for CATSCIENTIST 220. CATSCIENTIST Lv 1 1 pt. 8,523

Comments