Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for EthylenDiaminTetraEssigsure 221. EthylenDiaminTetraEssigsure Lv 1 1 pt. 8,522
  2. Avatar for Jamez42 222. Jamez42 Lv 1 1 pt. 8,511
  3. Avatar for teunlammetje 223. teunlammetje Lv 1 1 pt. 8,507
  4. Avatar for bacar 224. bacar Lv 1 1 pt. 8,479
  5. Avatar for Malvados 225. Malvados Lv 1 1 pt. 8,417
  6. Avatar for JonVose 226. JonVose Lv 1 1 pt. 8,412
  7. Avatar for LELE1964 227. LELE1964 Lv 1 1 pt. 8,403
  8. Avatar for buggo 228. buggo Lv 1 1 pt. 8,397
  9. Avatar for kristicory 229. kristicory Lv 1 1 pt. 8,377
  10. Avatar for Hellomynameis1 230. Hellomynameis1 Lv 1 1 pt. 8,377

Comments