Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for vanemyosotis 231. vanemyosotis Lv 1 1 pt. 8,110
  2. Avatar for eromana 232. eromana Lv 1 1 pt. 7,950
  3. Avatar for UA_Trey 233. UA_Trey Lv 1 1 pt. 7,896
  4. Avatar for fischy92 234. fischy92 Lv 1 1 pt. 7,889
  5. Avatar for Tomas Ruiz Diaz 235. Tomas Ruiz Diaz Lv 1 1 pt. 7,846
  6. Avatar for C1234C5678 236. C1234C5678 Lv 1 1 pt. 7,629
  7. Avatar for KathlDattl 237. KathlDattl Lv 1 1 pt. 6,863
  8. Avatar for Bronzebart 238. Bronzebart Lv 1 1 pt. 6,623
  9. Avatar for mila60 239. mila60 Lv 1 1 pt. 5,640
  10. Avatar for yjnbgh 240. yjnbgh Lv 1 1 pt. 3,688

Comments