Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629

  1. Avatar for hiscience 241. hiscience Lv 1 1 pt. 2,472
  2. Avatar for alantgdg 242. alantgdg Lv 1 1 pt. 1,389
  3. Avatar for narrtest 243. narrtest Lv 1 1 pt. 1,289
  4. Avatar for llnzl 244. llnzl Lv 1 1 pt. 1,289
  5. Avatar for wl2003sq 249. wl2003sq Lv 1 1 pt. 1,289
  6. Avatar for DylanWolfe 250. DylanWolfe Lv 1 1 pt. 1,289

Comments