Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for Piotr137 251. Piotr137 Lv 1 1 pt. 1,289
  2. Avatar for Formula350 252. Formula350 Lv 1 1 pt. 1,289
  3. Avatar for TrolllBoy 253. TrolllBoy Lv 1 1 pt. 1,289
  4. Avatar for Elaine Zheng 254. Elaine Zheng Lv 1 1 pt. 1,289
  5. Avatar for Bletchley Park 255. Bletchley Park Lv 1 1 pt. 1,289
  6. Avatar for ken3ore 256. ken3ore Lv 1 1 pt. 1,289
  7. Avatar for Galbania 257. Galbania Lv 1 1 pt. 1,289
  8. Avatar for bertro 258. bertro Lv 1 1 pt. 1,289
  9. Avatar for Wolfe_Sierra_202003 259. Wolfe_Sierra_202003 Lv 1 1 pt. 1,289
  10. Avatar for drumpeter18yrs9yrs 260. drumpeter18yrs9yrs Lv 1 1 pt. 1,289

Comments