Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for bkoep 261. bkoep Lv 1 1 pt. 1,289
  2. Avatar for Tianyan Liu 262. Tianyan Liu Lv 1 1 pt. 1,289
  3. Avatar for tzugypsyl 263. tzugypsyl Lv 1 1 pt. 1,289
  4. Avatar for Evelyn Cruz 264. Evelyn Cruz Lv 1 1 pt. 1,289
  5. Avatar for fishercat 265. fishercat Lv 1 1 pt. 1,289
  6. Avatar for rmoretti 266. rmoretti Lv 1 1 pt. 1,289

Comments