Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for drjr 21. drjr Lv 1 68 pts. 9,724
  2. Avatar for robgee 22. robgee Lv 1 67 pts. 9,722
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 65 pts. 9,722
  4. Avatar for phi16 24. phi16 Lv 1 64 pts. 9,721
  5. Avatar for grogar7 25. grogar7 Lv 1 63 pts. 9,716
  6. Avatar for pmlkjn 26. pmlkjn Lv 1 61 pts. 9,711
  7. Avatar for BootsMcGraw 27. BootsMcGraw Lv 1 60 pts. 9,706
  8. Avatar for fpc 28. fpc Lv 1 59 pts. 9,706
  9. Avatar for Ignacio 29. Ignacio Lv 1 58 pts. 9,705
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 57 pts. 9,701

Comments