Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for johnmitch 31. johnmitch Lv 1 55 pts. 9,699
  2. Avatar for Blipperman 32. Blipperman Lv 1 54 pts. 9,697
  3. Avatar for Pazithi 33. Pazithi Lv 1 53 pts. 9,697
  4. Avatar for Norrjane 34. Norrjane Lv 1 52 pts. 9,694
  5. Avatar for OWM3 35. OWM3 Lv 1 51 pts. 9,680
  6. Avatar for cbwest 36. cbwest Lv 1 50 pts. 9,674
  7. Avatar for Philzord 37. Philzord Lv 1 49 pts. 9,673
  8. Avatar for WBarme1234 38. WBarme1234 Lv 1 48 pts. 9,666
  9. Avatar for LastAndroid 39. LastAndroid Lv 1 47 pts. 9,662
  10. Avatar for diamonddays 40. diamonddays Lv 1 46 pts. 9,653

Comments