Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629

  1. Avatar for tom2705 61. tom2705 Lv 1 28 pts. 9,559
  2. Avatar for rezaefar 62. rezaefar Lv 1 28 pts. 9,554
  3. Avatar for nicobul 63. nicobul Lv 1 27 pts. 9,552
  4. Avatar for zannipietro 64. zannipietro Lv 1 26 pts. 9,542
  5. Avatar for MING5MAK 65. MING5MAK Lv 1 26 pts. 9,537
  6. Avatar for JasperD 66. JasperD Lv 1 25 pts. 9,526
  7. Avatar for pvc78 67. pvc78 Lv 1 24 pts. 9,521
  8. Avatar for lraguette 68. lraguette Lv 1 24 pts. 9,519
  9. Avatar for Jpilkington 69. Jpilkington Lv 1 23 pts. 9,517
  10. Avatar for blazegeek 70. blazegeek Lv 1 23 pts. 9,511

Comments