Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Chem Eng Thermo 21. Chem Eng Thermo 1 pt. 8,730
  2. Avatar for Trinity Biology 22. Trinity Biology 1 pt. 8,694
  3. Avatar for Team China 23. Team China 1 pt. 7,629
  1. Avatar for Steven Pletsch 81. Steven Pletsch Lv 1 17 pts. 9,481
  2. Avatar for nspc 82. nspc Lv 1 17 pts. 9,481
  3. Avatar for Merf 83. Merf Lv 1 16 pts. 9,478
  4. Avatar for Tygh 84. Tygh Lv 1 16 pts. 9,472
  5. Avatar for vybi 85. vybi Lv 1 15 pts. 9,468
  6. Avatar for Deleted player 86. Deleted player pts. 9,468
  7. Avatar for Pikamander2 87. Pikamander2 Lv 1 15 pts. 9,467
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 14 pts. 9,465
  9. Avatar for carsonfb 89. carsonfb Lv 1 14 pts. 9,463
  10. Avatar for Hellcat6 90. Hellcat6 Lv 1 13 pts. 9,463

Comments