Placeholder image of a protein
Icon representing a puzzle

1839: Revisiting Puzzle 117: Transport Mutant

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 14, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,766
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,764
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,764
  4. Avatar for Team India 4. Team India 49 pts. 9,763
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 9,743
  6. Avatar for Contenders 6. Contenders 28 pts. 9,741
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 9,720
  8. Avatar for CHNO Junkies 8. CHNO Junkies 15 pts. 9,711
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,706
  10. Avatar for Penny-Arcade 10. Penny-Arcade 8 pts. 9,662
  1. Avatar for Scopper 41. Scopper Lv 1 45 pts. 9,650
  2. Avatar for CharlieFortsConscience 42. CharlieFortsConscience Lv 1 44 pts. 9,649
  3. Avatar for spdenne 43. spdenne Lv 1 43 pts. 9,647
  4. Avatar for jamiexq 44. jamiexq Lv 1 42 pts. 9,646
  5. Avatar for marsfan 45. marsfan Lv 1 41 pts. 9,645
  6. Avatar for martin.kendig@verizon.net 46. martin.kendig@verizon.net Lv 1 40 pts. 9,640
  7. Avatar for Timo van der Laan 47. Timo van der Laan Lv 1 39 pts. 9,638
  8. Avatar for stomjoh 48. stomjoh Lv 1 38 pts. 9,630
  9. Avatar for Alistair69 49. Alistair69 Lv 1 37 pts. 9,605
  10. Avatar for kevin everington 50. kevin everington Lv 1 36 pts. 9,603

Comments