Placeholder image of a protein
Icon representing a puzzle

1841: Coronavirus NSP6 Prediction

Closed since almost 6 years ago

Intermediate

Summary


Created
May 21, 2020
Expires
Max points
100
Description

Note: This puzzle was originally posted with an incorrect sequence. It was closed early and replaced by Puzzle 1841b.



Fold this coronavirus protein! This is a portion of a larger protein encoded in the viral genome of SARS-CoV-2. It is encoded in a region of the genome called NSP6, but the protein's structure and function are still unknown. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


CTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ

Top groups


  1. Avatar for Contenders 100 pts. 10,449
  2. Avatar for Go Science 2. Go Science 56 pts. 9,987
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 9,250
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 14 pts. 9,006
  5. Avatar for Gargleblasters 5. Gargleblasters 6 pts. 8,939
  6. Avatar for Penny-Arcade 6. Penny-Arcade 2 pts. 8,885
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 8,434
  8. Avatar for Hold My Beer 9. Hold My Beer 1 pt. 8,260
  9. Avatar for Mojo Risin' 10. Mojo Risin' 1 pt. 8,066

  1. Avatar for puxatudo
    1. puxatudo Lv 1
    100 pts. 9,784
  2. Avatar for fisherlr777 2. fisherlr777 Lv 1 1 pt. 9,773

Comments


Susume Lv 1

The AA sequence in the game is the same one we had for 1835, an nsp2 domain. The sequence in the puzzle comments is for an nsp6 domain - probably what we were supposed to get.