Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911

  1. Avatar for kitek314_pl 91. kitek314_pl Lv 1 8 pts. 10,182
  2. Avatar for cbwest 92. cbwest Lv 1 8 pts. 10,171
  3. Avatar for infjamc 93. infjamc Lv 1 7 pts. 10,166
  4. Avatar for pizpot 94. pizpot Lv 1 7 pts. 10,159
  5. Avatar for Chris Klassen 95. Chris Klassen Lv 1 7 pts. 10,152
  6. Avatar for RW-QuantumSec 96. RW-QuantumSec Lv 1 7 pts. 10,150
  7. Avatar for abiogenesis 97. abiogenesis Lv 1 6 pts. 10,148
  8. Avatar for argyrw 98. argyrw Lv 1 6 pts. 10,145
  9. Avatar for spdenne 99. spdenne Lv 1 6 pts. 10,139
  10. Avatar for jsfoldingaccount 100. jsfoldingaccount Lv 1 6 pts. 10,138

Comments