Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for MING5MAK 121. MING5MAK Lv 1 2 pts. 9,944
  2. Avatar for bcre8tvv 122. bcre8tvv Lv 1 2 pts. 9,940
  3. Avatar for Trajan464 123. Trajan464 Lv 1 2 pts. 9,939
  4. Avatar for devjosh 124. devjosh Lv 1 2 pts. 9,936
  5. Avatar for KateMidwife 125. KateMidwife Lv 1 2 pts. 9,931
  6. Avatar for lconor 126. lconor Lv 1 2 pts. 9,929
  7. Avatar for Vincera 127. Vincera Lv 1 2 pts. 9,915
  8. Avatar for HOP_jennygidicsin 128. HOP_jennygidicsin Lv 1 2 pts. 9,909
  9. Avatar for marsfan 129. marsfan Lv 1 2 pts. 9,906
  10. Avatar for Rhowena 130. Rhowena Lv 1 2 pts. 9,903

Comments