Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for Hustvedt 131. Hustvedt Lv 1 2 pts. 9,896
  2. Avatar for donuts554 132. donuts554 Lv 1 2 pts. 9,894
  3. Avatar for pangaena 133. pangaena Lv 1 2 pts. 9,886
  4. Avatar for Beany 134. Beany Lv 1 2 pts. 9,882
  5. Avatar for heyubob 135. heyubob Lv 1 1 pt. 9,881
  6. Avatar for sitlux 136. sitlux Lv 1 1 pt. 9,879
  7. Avatar for dam904 137. dam904 Lv 1 1 pt. 9,879
  8. Avatar for Slense 138. Slense Lv 1 1 pt. 9,866
  9. Avatar for justjustin 139. justjustin Lv 1 1 pt. 9,858
  10. Avatar for Altercomp 140. Altercomp Lv 1 1 pt. 9,850

Comments