Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for Bucsan 151. Bucsan Lv 1 1 pt. 9,753
  2. Avatar for Datstandin 152. Datstandin Lv 1 1 pt. 9,704
  3. Avatar for skovz99 153. skovz99 Lv 1 1 pt. 9,689
  4. Avatar for xabxs 154. xabxs Lv 1 1 pt. 9,663
  5. Avatar for fishercat 155. fishercat Lv 1 1 pt. 9,662
  6. Avatar for Simek 156. Simek Lv 1 1 pt. 9,650
  7. Avatar for Golgi42370 157. Golgi42370 Lv 1 1 pt. 9,630
  8. Avatar for Raborlatte 158. Raborlatte Lv 1 1 pt. 9,623
  9. Avatar for OeshaHari 159. OeshaHari Lv 1 1 pt. 9,618
  10. Avatar for Jpilkington 160. Jpilkington Lv 1 1 pt. 9,586

Comments