Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for molleke 171. molleke Lv 1 1 pt. 9,474
  2. Avatar for Rakk 172. Rakk Lv 1 1 pt. 9,458
  3. Avatar for boondog 173. boondog Lv 1 1 pt. 9,445
  4. Avatar for rene1010 174. rene1010 Lv 1 1 pt. 9,425
  5. Avatar for Alec_C 175. Alec_C Lv 1 1 pt. 9,417
  6. Avatar for hbienert 176. hbienert Lv 1 1 pt. 9,409
  7. Avatar for Dr.Sillem 177. Dr.Sillem Lv 1 1 pt. 9,408
  8. Avatar for haggisfam 178. haggisfam Lv 1 1 pt. 9,400
  9. Avatar for CESAR RAMIREZ 179. CESAR RAMIREZ Lv 1 1 pt. 9,385
  10. Avatar for Lu joel 180. Lu joel Lv 1 1 pt. 9,354

Comments