1842: Revisiting Puzzle 124: PDZ Domain
Closed since almost 6 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- May 21, 2020
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV
Top groups
Comments