Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 80 pts. 10,839
  2. Avatar for johnmitch 12. johnmitch Lv 1 78 pts. 10,828
  3. Avatar for ZeroLeak7 13. ZeroLeak7 Lv 1 76 pts. 10,824
  4. Avatar for Deleted player 14. Deleted player pts. 10,804
  5. Avatar for TECHFREAK 15. TECHFREAK Lv 1 73 pts. 10,802
  6. Avatar for Aubade01 16. Aubade01 Lv 1 71 pts. 10,802
  7. Avatar for fiendish_ghoul 17. fiendish_ghoul Lv 1 69 pts. 10,792
  8. Avatar for drjr 18. drjr Lv 1 68 pts. 10,784
  9. Avatar for aznarog 19. aznarog Lv 1 66 pts. 10,775
  10. Avatar for guineapig 20. guineapig Lv 1 64 pts. 10,768

Comments