Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for xhthechicken 211. xhthechicken Lv 1 1 pt. 8,165
  2. Avatar for puxatudo 212. puxatudo Lv 1 1 pt. 8,165
  3. Avatar for Puttering 213. Puttering Lv 1 1 pt. 8,165
  4. Avatar for Knuspy 214. Knuspy Lv 1 1 pt. 8,165
  5. Avatar for Susume 215. Susume Lv 1 1 pt. 8,165
  6. Avatar for joshmiller 216. joshmiller Lv 1 1 pt. 8,165
  7. Avatar for Luke_ver 217. Luke_ver Lv 1 1 pt. 8,165
  8. Avatar for fisherlr777 218. fisherlr777 Lv 1 1 pt. 8,165
  9. Avatar for EZBioTIme 219. EZBioTIme Lv 1 1 pt. 8,165
  10. Avatar for alcor29 220. alcor29 Lv 1 1 pt. 8,165

Comments