Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for heather-1 71. heather-1 Lv 1 15 pts. 10,337
  2. Avatar for WBarme1234 72. WBarme1234 Lv 1 15 pts. 10,331
  3. Avatar for MrZanav 73. MrZanav Lv 1 14 pts. 10,326
  4. Avatar for Alistair69 74. Alistair69 Lv 1 14 pts. 10,325
  5. Avatar for meatexplosion 75. meatexplosion Lv 1 14 pts. 10,324
  6. Avatar for fpc 76. fpc Lv 1 13 pts. 10,314
  7. Avatar for Dolichwier 77. Dolichwier Lv 1 13 pts. 10,295
  8. Avatar for Pawel Tluscik 78. Pawel Tluscik Lv 1 12 pts. 10,287
  9. Avatar for lraguette 79. lraguette Lv 1 12 pts. 10,268
  10. Avatar for kludbrook 80. kludbrook Lv 1 11 pts. 10,260

Comments