Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,642
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 10,491
  3. Avatar for Russian team 13. Russian team 1 pt. 10,254
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,209
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,196
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 10,083
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 9,754
  8. Avatar for Window Group 18. Window Group 1 pt. 8,911
  1. Avatar for John McLeod 81. John McLeod Lv 1 11 pts. 10,260
  2. Avatar for ComputerMage 82. ComputerMage Lv 1 11 pts. 10,254
  3. Avatar for jsmith86 83. jsmith86 Lv 1 10 pts. 10,243
  4. Avatar for aendgraend 84. aendgraend Lv 1 10 pts. 10,209
  5. Avatar for nathalie friess salido 85. nathalie friess salido Lv 1 10 pts. 10,203
  6. Avatar for Formula350 86. Formula350 Lv 1 9 pts. 10,200
  7. Avatar for wudoo 87. wudoo Lv 1 9 pts. 10,199
  8. Avatar for ShadowTactics 88. ShadowTactics Lv 1 9 pts. 10,196
  9. Avatar for rabamino12358 89. rabamino12358 Lv 1 8 pts. 10,193
  10. Avatar for iplfd 90. iplfd Lv 1 8 pts. 10,188

Comments