Placeholder image of a protein
Icon representing a puzzle

1842: Revisiting Puzzle 124: PDZ Domain

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,978
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,976
  3. Avatar for Contenders 3. Contenders 54 pts. 10,972
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,957
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,888
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,843
  7. Avatar for Team India 7. Team India 12 pts. 10,802
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,775
  9. Avatar for CHNO Junkies 9. CHNO Junkies 5 pts. 10,737
  10. Avatar for Penny-Arcade 10. Penny-Arcade 3 pts. 10,721
  1. Avatar for KarenCH 21. KarenCH Lv 1 63 pts. 10,748
  2. Avatar for pmlkjn 22. pmlkjn Lv 1 61 pts. 10,737
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 60 pts. 10,736
  4. Avatar for LastAndroid 24. LastAndroid Lv 1 58 pts. 10,731
  5. Avatar for silent gene 25. silent gene Lv 1 57 pts. 10,731
  6. Avatar for georg137 26. georg137 Lv 1 55 pts. 10,731
  7. Avatar for jobo0502 27. jobo0502 Lv 1 54 pts. 10,710
  8. Avatar for CharlieFortsConscience 28. CharlieFortsConscience Lv 1 53 pts. 10,709
  9. Avatar for Skippysk8s 29. Skippysk8s Lv 1 51 pts. 10,708
  10. Avatar for g_b 30. g_b Lv 1 50 pts. 10,696

Comments