Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,241
  2. Avatar for Galaxie 2. Galaxie Lv 1 83 pts. 10,185
  3. Avatar for LociOiling 3. LociOiling Lv 1 68 pts. 10,159
  4. Avatar for pente_player 4. pente_player Lv 1 55 pts. 10,150
  5. Avatar for puxatudo 5. puxatudo Lv 1 44 pts. 10,144
  6. Avatar for mirp 6. mirp Lv 1 35 pts. 10,140
  7. Avatar for silent gene 7. silent gene Lv 1 27 pts. 10,139
  8. Avatar for fisherlr777 8. fisherlr777 Lv 1 21 pts. 10,137
  9. Avatar for Czim 9. Czim Lv 1 16 pts. 10,136
  10. Avatar for jsmith86 10. jsmith86 Lv 1 12 pts. 10,133

Comments