Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for Hellcat6 101. Hellcat6 Lv 1 5 pts. 9,736
  2. Avatar for jsfoldingaccount 102. jsfoldingaccount Lv 1 4 pts. 9,735
  3. Avatar for joremen 103. joremen Lv 1 4 pts. 9,727
  4. Avatar for infjamc 104. infjamc Lv 1 4 pts. 9,727
  5. Avatar for dam904 105. dam904 Lv 1 4 pts. 9,711
  6. Avatar for ProfVince 106. ProfVince Lv 1 4 pts. 9,704
  7. Avatar for Czim 107. Czim Lv 1 4 pts. 9,701
  8. Avatar for Philzord 108. Philzord Lv 1 3 pts. 9,678
  9. Avatar for jamiexq 109. jamiexq Lv 1 3 pts. 9,643
  10. Avatar for thewholeblahthing 110. thewholeblahthing Lv 1 3 pts. 9,639

Comments