Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for avalux 151. avalux Lv 1 1 pt. 9,238
  2. Avatar for IlseGh 152. IlseGh Lv 1 1 pt. 9,229
  3. Avatar for Jenot96 153. Jenot96 Lv 1 1 pt. 9,227
  4. Avatar for pruneau_44 154. pruneau_44 Lv 1 1 pt. 9,223
  5. Avatar for fisherlr777 155. fisherlr777 Lv 1 1 pt. 9,217
  6. Avatar for Dr.Sillem 156. Dr.Sillem Lv 1 1 pt. 9,215
  7. Avatar for WilliamII 157. WilliamII Lv 1 1 pt. 9,204
  8. Avatar for tlaran 158. tlaran Lv 1 1 pt. 9,194
  9. Avatar for cbwest 159. cbwest Lv 1 1 pt. 9,185
  10. Avatar for BrittaBarny 160. BrittaBarny Lv 1 1 pt. 9,182

Comments