Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155

  1. Avatar for HMK 161. HMK Lv 1 1 pt. 9,155
  2. Avatar for AlkiP0Ps 162. AlkiP0Ps Lv 1 1 pt. 9,142
  3. Avatar for Mohoernchen 163. Mohoernchen Lv 1 1 pt. 9,126
  4. Avatar for ester141 164. ester141 Lv 1 1 pt. 9,115
  5. Avatar for heather-1 165. heather-1 Lv 1 1 pt. 9,088
  6. Avatar for justjustin 166. justjustin Lv 1 1 pt. 9,063
  7. Avatar for ManVsYard 167. ManVsYard Lv 1 1 pt. 9,054
  8. Avatar for Pibeagles1 168. Pibeagles1 Lv 1 1 pt. 9,053
  9. Avatar for rinze 169. rinze Lv 1 1 pt. 9,040
  10. Avatar for Fouggia 170. Fouggia Lv 1 1 pt. 9,010

Comments