Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155

  1. Avatar for RainGrey 201. RainGrey Lv 1 1 pt. 7,227
  2. Avatar for grea110 202. grea110 Lv 1 1 pt. 6,860
  3. Avatar for mhutson 203. mhutson Lv 1 1 pt. 6,766
  4. Avatar for Staximus 204. Staximus Lv 1 1 pt. 6,673
  5. Avatar for meatexplosion 205. meatexplosion Lv 1 1 pt. 6,488
  6. Avatar for Elaine Zheng 206. Elaine Zheng Lv 1 1 pt. 6,488
  7. Avatar for Astrospacy 208. Astrospacy Lv 1 1 pt. 6,488
  8. Avatar for Puttering 209. Puttering Lv 1 1 pt. 6,488
  9. Avatar for Mike Cassidy 210. Mike Cassidy Lv 1 1 pt. 6,488

Comments