Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for LastAndroid 31. LastAndroid Lv 1 47 pts. 10,066
  2. Avatar for Joanna_H 32. Joanna_H Lv 1 46 pts. 10,065
  3. Avatar for CharlieFortsConscience 33. CharlieFortsConscience Lv 1 45 pts. 10,059
  4. Avatar for John McLeod 34. John McLeod Lv 1 43 pts. 10,058
  5. Avatar for georg137 35. georg137 Lv 1 42 pts. 10,046
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 41 pts. 10,045
  7. Avatar for SKSbell 37. SKSbell Lv 1 40 pts. 10,043
  8. Avatar for pvc78 38. pvc78 Lv 1 39 pts. 10,042
  9. Avatar for Hustvedt 39. Hustvedt Lv 1 38 pts. 10,042
  10. Avatar for guineapig 40. guineapig Lv 1 37 pts. 10,040

Comments