Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for wboler 41. wboler Lv 1 36 pts. 10,037
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 35 pts. 10,036
  3. Avatar for malphis 43. malphis Lv 1 34 pts. 10,032
  4. Avatar for martin.kendig@verizon.net 44. martin.kendig@verizon.net Lv 1 33 pts. 10,029
  5. Avatar for phi16 45. phi16 Lv 1 32 pts. 10,029
  6. Avatar for fiendish_ghoul 46. fiendish_ghoul Lv 1 31 pts. 10,019
  7. Avatar for Merf 47. Merf Lv 1 30 pts. 10,016
  8. Avatar for Steven Pletsch 48. Steven Pletsch Lv 1 29 pts. 10,013
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 28 pts. 10,008
  10. Avatar for Polarstern 50. Polarstern Lv 1 27 pts. 10,005

Comments