Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for OWM3 51. OWM3 Lv 1 27 pts. 9,999
  2. Avatar for pmlkjn 52. pmlkjn Lv 1 26 pts. 9,998
  3. Avatar for alwen 53. alwen Lv 1 25 pts. 9,997
  4. Avatar for Todd6485577 54. Todd6485577 Lv 1 24 pts. 9,978
  5. Avatar for Blipperman 55. Blipperman Lv 1 23 pts. 9,978
  6. Avatar for aznarog 56. aznarog Lv 1 23 pts. 9,974
  7. Avatar for wudoo 57. wudoo Lv 1 22 pts. 9,974
  8. Avatar for hansvandenhof 58. hansvandenhof Lv 1 21 pts. 9,972
  9. Avatar for Sadaharu06.jp 59. Sadaharu06.jp Lv 1 21 pts. 9,971
  10. Avatar for Superphosphate 60. Superphosphate Lv 1 20 pts. 9,970

Comments