Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,835
  2. Avatar for Russian team 12. Russian team 1 pt. 9,803
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,618
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,587
  5. Avatar for Chem Eng Thermo 15. Chem Eng Thermo 1 pt. 9,520
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,440
  7. Avatar for Deleted group 17. Deleted group pts. 9,390
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,155
  1. Avatar for zeluis 81. zeluis Lv 1 10 pts. 9,844
  2. Avatar for TastyMunchies 82. TastyMunchies Lv 1 10 pts. 9,841
  3. Avatar for Vinara 83. Vinara Lv 1 9 pts. 9,836
  4. Avatar for Jajaboman 84. Jajaboman Lv 1 9 pts. 9,835
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 9 pts. 9,832
  6. Avatar for smmalis37 86. smmalis37 Lv 1 8 pts. 9,828
  7. Avatar for GriffJ572 87. GriffJ572 Lv 1 8 pts. 9,812
  8. Avatar for not_publius 88. not_publius Lv 1 8 pts. 9,810
  9. Avatar for lraguette 89. lraguette Lv 1 7 pts. 9,807
  10. Avatar for ComputerMage 90. ComputerMage Lv 1 7 pts. 9,803

Comments