Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for georg137 11. georg137 Lv 1 9 pts. 10,109
  2. Avatar for CharlieFortsConscience 12. CharlieFortsConscience Lv 1 7 pts. 10,108
  3. Avatar for KarenCH 13. KarenCH Lv 1 5 pts. 10,089
  4. Avatar for Anfinsen_slept_here 14. Anfinsen_slept_here Lv 1 4 pts. 10,067
  5. Avatar for alwen 15. alwen Lv 1 3 pts. 10,059
  6. Avatar for robgee 16. robgee Lv 1 2 pts. 10,059
  7. Avatar for fpc 17. fpc Lv 1 1 pt. 10,058
  8. Avatar for Jpilkington 18. Jpilkington Lv 1 1 pt. 10,057
  9. Avatar for Blipperman 19. Blipperman Lv 1 1 pt. 10,056
  10. Avatar for John McLeod 20. John McLeod Lv 1 1 pt. 10,047

Comments