Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998

  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 10,207
  2. Avatar for grogar7 2. grogar7 Lv 1 98 pts. 10,180
  3. Avatar for Aubade01 3. Aubade01 Lv 1 96 pts. 10,180
  4. Avatar for LociOiling 4. LociOiling Lv 1 94 pts. 10,162
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 91 pts. 10,155
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 89 pts. 10,152
  7. Avatar for MicElephant 7. MicElephant Lv 1 87 pts. 10,136
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 85 pts. 10,132
  9. Avatar for Galaxie 9. Galaxie Lv 1 83 pts. 10,130
  10. Avatar for Mikisp 10. Mikisp Lv 1 81 pts. 10,127

Comments