Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  7. Avatar for Team China 18. Team China 1 pt. 9,048
  8. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  9. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696

  1. Avatar for joshmiller
    1. joshmiller Lv 1
    100 pts. 11,569
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 85 pts. 11,201
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 72 pts. 11,200
  4. Avatar for Dhalion 4. Dhalion Lv 1 61 pts. 11,199
  5. Avatar for Xartos 5. Xartos Lv 1 51 pts. 11,198
  6. Avatar for Czim 6. Czim Lv 1 42 pts. 11,197
  7. Avatar for mirp 7. mirp Lv 1 35 pts. 11,195
  8. Avatar for Phyx 8. Phyx Lv 1 28 pts. 11,195
  9. Avatar for pente_player 9. pente_player Lv 1 23 pts. 11,188
  10. Avatar for puxatudo 10. puxatudo Lv 1 19 pts. 11,140

Comments