Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for Kangwon_National_University_Computers_in_Chemistry 16. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,362
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  8. Avatar for Team China 18. Team China 1 pt. 9,048
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  10. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696
  1. Avatar for wudoo 121. wudoo Lv 1 2 pts. 9,658
  2. Avatar for RW-QuantumSec 122. RW-QuantumSec Lv 1 2 pts. 9,639
  3. Avatar for Crossed Sticks 123. Crossed Sticks Lv 1 1 pt. 9,636
  4. Avatar for aniri 124. aniri Lv 1 1 pt. 9,624
  5. Avatar for drumpeter18yrs9yrs 125. drumpeter18yrs9yrs Lv 1 1 pt. 9,617
  6. Avatar for xbp 126. xbp Lv 1 1 pt. 9,578
  7. Avatar for fishercat 127. fishercat Lv 1 1 pt. 9,577
  8. Avatar for Evica 128. Evica Lv 1 1 pt. 9,575
  9. Avatar for Superphosphate 129. Superphosphate Lv 1 1 pt. 9,555
  10. Avatar for Ann2001 130. Ann2001 Lv 1 1 pt. 9,547

Comments