Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for Kangwon_National_University_Computers_in_Chemistry 16. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,362
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  8. Avatar for Team China 18. Team China 1 pt. 9,048
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  10. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696
  1. Avatar for Trajan464 141. Trajan464 Lv 1 1 pt. 9,423
  2. Avatar for frostschutz 142. frostschutz Lv 1 1 pt. 9,421
  3. Avatar for Dolichwier 143. Dolichwier Lv 1 1 pt. 9,417
  4. Avatar for KingoRodriguo 144. KingoRodriguo Lv 1 1 pt. 9,416
  5. Avatar for Pibeagles1 145. Pibeagles1 Lv 1 1 pt. 9,414
  6. Avatar for devjosh 146. devjosh Lv 1 1 pt. 9,394
  7. Avatar for tzugypsyl 147. tzugypsyl Lv 1 1 pt. 9,384
  8. Avatar for Mikisp 148. Mikisp Lv 1 1 pt. 9,382
  9. Avatar for 201713434 149. 201713434 Lv 1 1 pt. 9,362
  10. Avatar for dldahlen 150. dldahlen Lv 1 1 pt. 9,340

Comments